PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00860.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 355aa    MW: 38768.9 Da    PI: 5.2328
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00860.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-184592148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    rg+W+ eEd llv++++++G g+W++ ar  g++Rt+k+c++rw++yl
  Zmw_sc00860.1.g00020.1.am.mkhc 45 RGPWSLEEDVLLVNYIAKHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 92
                                    89********************************************97 PP

2Myb_DNA-binding53.84.4e-1798141146
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                     rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Zmw_sc00860.1.g00020.1.am.mkhc  98 RGNITPEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 141
                                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6774092IPR017930Myb domain
SuperFamilySSF466891.5E-3142139IPR009057Homeodomain-like
SMARTSM007172.1E-154494IPR001005SANT/Myb domain
PfamPF002498.7E-174592IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-224699IPR009057Homeodomain-like
CDDcd001671.42E-124792No hitNo description
PROSITE profilePS5129424.24893147IPR017930Myb domain
SMARTSM007171.6E-1597145IPR001005SANT/Myb domain
PfamPF002496.8E-1698141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-24100146IPR009057Homeodomain-like
CDDcd001671.43E-12102141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MDVAAVTGMV GNFDDDQLEE AMGMSLAGSA AVSAVGSEDE ADLRRGPWSL EEDVLLVNYI  60
AKHGEGRWNS LARSAGLKRT GKSCRLRWLN YLRPDVRRGN ITPEEQLLIL ELHSRWGNRW  120
SKIAQHLPGR TDNEIKNYWR TRVQKHAKQL RCEVNSRQFR DVVRFVWMPR LVERIQAEAG  180
AGGAHEAAAM AVGVLAPATT VSAPAACQMS ASAYSRQSGA PLNEQAAHQC RHHEHTDYYY  240
NESAGQTAAA MSPDDTSSAL RSTITAEASH AQHQLASTTT TPTNEGGGVM QCGGAATDDV  300
VVQEDVFGFG GSWSDLLATT GCGESMISLP DFELGDFEDN VWSQEDLGLH QQHWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-26421451103MYB PROTO-ONCOGENE PROTEIN
1msf_C1e-25431452103C-Myb DNA-Binding Domain
1mse_C1e-25431452103C-Myb DNA-Binding Domain
1a5j_A1e-25421454106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700181.11e-128PREDICTED: transcriptional activator Myb
TrEMBLK3Z7F41e-128K3Z7F4_SETIT; Uncharacterized protein
STRINGSi022474m1e-127(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330